PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN540070.1_FGP005
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 582aa    MW: 63588.1 Da    PI: 7.5009
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN540070.1_FGP005genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox71.59.9e-2351106156
                        TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        +++ +++t++q++eLe++F+++++p++++r+eL+k+lgL+ rqVk+WFqNrR+++k
  KN540070.1_FGP005  51 KKRYHRHTPQQIQELEAMFKECPHPDEKQRAELSKRLGLEPRQVKFWFQNRRTQMK 106
                        688999***********************************************998 PP

2START912.5e-2916931890206
                        EEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--......-TTSEE-EESSEEEEEEEECTCE.............. CS
              START  90 alqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.....sssvvRaellpSgiliepksngh.............. 161
                        +l  m+aelq+lsplvp R++ f+R+++ql +g+w++vdvS d+    +      s   + +++lpSg+++++++ng               
  KN540070.1_FGP005 169 ELSRMQAELQVLSPLVPiREVKFLRFSKQLADGVWAVVDVSADELMRDQGitsasSTANMNCRRLPSGCVLQDTPNGFvkylvqisvfsevy 260
                        6788**************************************9987666666454555689******************************* PP

                        .............EEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
              START 162 .............skvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                                       vtwveh++++++++h l+r+l++sgla ga +w atlqrqce+
  KN540070.1_FGP005 261 nlsidqfmdlppaFMVTWVEHTEYDEASVHPLYRPLLRSGLALGAGRWIATLQRQCEC 318
                        ************99******************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.6E-2231106IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.0E-2344114IPR009057Homeodomain-like
PROSITE profilePS5007118.36648108IPR001356Homeobox domain
SMARTSM003893.2E-2049112IPR001356Homeobox domain
CDDcd000865.34E-2150106No hitNo description
PfamPF000464.9E-2051106IPR001356Homeobox domain
PRINTSPR000314.7E-57988IPR000047Helix-turn-helix motif
PROSITE patternPS00027083106IPR017970Homeobox, conserved site
PRINTSPR000314.7E-588104IPR000047Helix-turn-helix motif
PfamPF018521.0E-23169318IPR002913START domain
SuperFamilySSF559614.21E-11172245No hitNo description
PROSITE profilePS5084822.766179321IPR002913START domain
SuperFamilySSF559614.21E-11273318No hitNo description
SuperFamilySSF559619.71E-15335548No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 582 aa     Download sequence    Send to blast
MSFGVGDHFG DGVVPAGMQF PYSGAGPGVF ASSPALSLAL DAEHGNPPKR KKRYHRHTPQ  60
QIQELEAMFK ECPHPDEKQR AELSKRLGLE PRQVKFWFQN RRTQMKMQLE RHENALLKQE  120
NDKLRSENLS IREATSNAVC VGCGGPAMLG EVSLEEHHLR VENARLKDEL SRMQAELQVL  180
SPLVPIREVK FLRFSKQLAD GVWAVVDVSA DELMRDQGIT SASSTANMNC RRLPSGCVLQ  240
DTPNGFVKYL VQISVFSEVY NLSIDQFMDL PPAFMVTWVE HTEYDEASVH PLYRPLLRSG  300
LALGAGRWIA TLQRQCECLA ILMSSIALPE NDSSGKRSML KLARRMTDNF CAGVSTSSTR  360
EWSKLVGLTG NIGEDVHVMA RKSVDEPGTP PGVVLSAATS VWMPVMPERL FNFLRNKGLR  420
AEWDILSNGG PMQEVTSIAK GQQNGNTVCL LKASSSAPLT KNFTVQPTKD KQNSMLILQE  480
TCADASGSMV VYAPVDIPAM HLVMSGGDSS CVALLPSGFA ILPAGPSIGA DHKMGGSLLT  540
VAFQILANSQ PSAKLTAESV ETVSNLISCT IKKIKTALHC DV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1119140.0AK111914.1 Oryza sativa Japonica Group cDNA clone:J033128F17, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015637147.10.0PREDICTED: homeobox-leucine zipper protein ROC4
SwissprotQ7Y0V90.0ROC4_ORYSJ; Homeobox-leucine zipper protein ROC4
TrEMBLA0A0E0KU370.0A0A0E0KU37_ORYPU; Uncharacterized protein
STRINGBGIOSGA014527-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP120337116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61150.11e-148homeodomain GLABROUS 1